PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004511084.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 221aa    MW: 24596.3 Da    PI: 8.3929
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004511084.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.18.2e-4571061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++C++apyfp +qp+kfanvh++FGasnv+kll++l++++reda++sl+yeAe+r+rdPvyG+vgvi+ lq+ql+ql+ +l 
  XP_004511084.1   7 PCAACKFLRRKCQPECAFAPYFPPDQPQKFANVHRIFGASNVTKLLNDLHPHQREDAVNSLAYEAEMRLRDPVYGCVGVISLLQHQLRQLQMDLY 101
                     7********************************************************************************************99 PP

          DUF260  96 llkee 100
                      +k+e
  XP_004511084.1 102 CAKSE 106
                     88876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9466107IPR004883Lateral organ boundaries, LOB
PfamPF031959.0E-447103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MASSNSPCAA CKFLRRKCQP ECAFAPYFPP DQPQKFANVH RIFGASNVTK LLNDLHPHQR  60
EDAVNSLAYE AEMRLRDPVY GCVGVISLLQ HQLRQLQMDL YCAKSELSRY QNLSIAATTG  120
HGLMTNESVA AVNNYHHTQN TTAVVGGNSN GRDHHYHHRH HQFFPNQQNN IVRNFDGGIG  180
NNYDTSLLAM NISASLGQFN QVQHHSAAGG GGEDRRTVNR S
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1507681e-119KF150768.1 Medicago truncatula var. truncatula AS2 mRNA, complete cds.
GenBankKF1507701e-119KF150770.1 Medicago truncatula var. truncatula AS2 gene, promoter region.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004511083.11e-166PREDICTED: LOB domain-containing protein 6
RefseqXP_004511084.11e-166PREDICTED: LOB domain-containing protein 6
RefseqXP_012574270.11e-166PREDICTED: LOB domain-containing protein 6
SwissprotO044795e-77LBD6_ARATH; LOB domain-containing protein 6
TrEMBLA0A072TNP91e-129A0A072TNP9_MEDTR; Lateral organ boundaries (LOB) domain protein
TrEMBLV5RG591e-129V5RG59_MEDTR; AS2
STRINGVIT_00s0340g00090.t011e-100(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.46e-75LBD family protein